SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033263m|PACid:19712471 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033263m|PACid:19712471
Domain Number 1 Region: 23-70,116-142
Classification Level Classification E-value
Superfamily F-box domain 0.000000000101
Family F-box domain 0.0069
Further Details:      
 
Domain Number 2 Region: 116-357
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000693
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033263m|PACid:19712471
Sequence length 374
Sequence
PLSAAGLPTAPQMDPAAALADMDELVEEVLLRSPPDDPAHLVRAALVCKRWCRILADAGF
RRRFRKLHRTPPMLGILHRHTHASYVTTFTATSSFRPRNGDLLRDWCALDSRHGRVLLAG
LPLRDDPSENNLSVWDPVTGEQLELPEQPQHPNRVPFGWNATVLCPDGACDHLDCGRGPF
LVVVVGTDFDGGFVYAYSSEAGAWRDPTYAAHYGGDPLNFFFFDPCAYVENALYFMFHRD
MKPGILEYNLGTHEISQDLLPHYLDRGVLTTTENGGLGFAAVDWSRLYLWSREAGRDGYP
IWAQSRTIELNIMFPADCPLLSSCMIGSVHGLHVFFVSTVDGIFSIDLKSGRMRKVCKER
DIENFVPYMSFCTP
Download sequence
Identical sequences K4A310
Si033263m|PACid:19712471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]