SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033267m|PACid:19711922 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033267m|PACid:19711922
Domain Number 1 Region: 34-94
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000113
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 72-89,162-374
Classification Level Classification E-value
Superfamily RNI-like 0.0000000288
Family 28-residue LRR 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033267m|PACid:19711922
Sequence length 402
Sequence
MARSTRKSAAPPSHVPEAGRSRKRQRSNKRDHGGRDWISALPDEILVAILHGLDAKTAVS
TSLLSRRWRHLWKSLRSLRLSEVSLPDDASWVRLGPMREEYLKANKVNHFVPSLRWFSEI
IKKRSAADDNEALRGLSVVFSGSAECAGAVDGAIAAASEQGVKGIDVAVVGDTRLTKYEF
PSWPFSDDGDITRSSSASPLASLRLNNCRLSVSESFQGFSALTKLVLVAMHMSLEDTTAV
LRSCKNLRSLYLIDMLDIRVVRHPRLEELVWLWPPPPSGALVIEAPALRRLEFWGAGEVL
PASTRRSSPCLEHVSLQFVVYGGRPDERHAKNLRNISARFPRVRSLHLRYQVPKLVVRPG
TPAIFSKLRVLTLSIDTKPSDDLLWMAMFVAAAPCLATLQTN
Download sequence
Identical sequences K4A314
Si033267m|PACid:19711922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]