SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033285m|PACid:19711433 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033285m|PACid:19711433
Domain Number 1 Region: 23-72
Classification Level Classification E-value
Superfamily F-box domain 8.24e-16
Family F-box domain 0.0061
Further Details:      
 
Domain Number 2 Region: 234-375
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000889
Family Galactose oxidase, central domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033285m|PACid:19711433
Sequence length 399
Sequence
MALSPRPRAASGSHAAPALAAGALPEDAIYEILLRLPAKDLCRLRAVCRPWRSLLSDPAF
AAAHAARHPEPLIVAGYTSHSVMNDDGILFDIMDQSGRVVRRIRQANNKEGHNERMVLVP
TQGDLVCLVQHWCRRSCRLLNPATGAVHVLPEGLAEEHAMHEGKLAYCALAFGQVAATGE
YKVLRVFRGYLPHGRELCEVFTLNGGSHGRWRGIRTAPPRNVILNLLNIVTICNGIVYFL
SIEHVPGDFILDDTIAPFNLESEEWMPTIRGPLSSLERAKNNDRSVLSLAVLNGCLVLSQ
HVVPSSMDMWFLMDVDKGLWVKQHCIQFEFSYWQIMHPVHPLLVLSDGRIVLIHMADRGL
LKMYNPRIGTCTDVAEIGPCDEIGLYTGNLLSLANGPSQ
Download sequence
Identical sequences K4A332
Si033285m|PACid:19711433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]