SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033296m|PACid:19711134 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033296m|PACid:19711134
Domain Number 1 Region: 23-64
Classification Level Classification E-value
Superfamily F-box domain 0.000000000589
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 107-336
Classification Level Classification E-value
Superfamily RNI-like 0.0000000341
Family Cyclin A/CDK2-associated p19, Skp2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033296m|PACid:19711134
Sequence length 455
Sequence
MVMATRAKKRRLEEEEKQERVDDFISGLPDGILCDIVTLLPTRDGARTQVLSSRWRHIWR
SAPLNLDLPEPLRRSPASDISRVLSAHPGPGRRFYVSYRRGLNHYSLDIDTMTLDGWLRS
PAIDGLRELEILLDHYRCMAKLVSLPPSVLRFSTLAVASFESCVLPDCGATHWPHLKKLT
LFSVTVSESSLHALLAGCSSIESLLLRDNRGFSRVKIVSPSLRSIGVSSIRGLDDDPRLR
QLVIEDAPCLERLLFFDGLGIGISVISAPRLDILGKLKGVGHMLQFGTTALQGSPVASLT
TVVPSVRVLALSHMKPCLDVVINLMKCFPHLENLHMKITHDGEENAWFDKYREPIDIRLR
KIVLAYFHDRKLHIEFAKFFVMNASVLESMTLELKHGSVGNDAWIRRQRRLLQVKKRASK
GARFDFVSRNGSFSLPRANQVHEMSILDPFQRVRQ
Download sequence
Identical sequences K4A343
Si033296m|PACid:19711134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]