SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033301m|PACid:19713914 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si033301m|PACid:19713914
Domain Number - Region: 67-120
Classification Level Classification E-value
Superfamily F-box domain 0.016
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033301m|PACid:19713914
Sequence length 350
Sequence
RAAASQARIPSPQAKRPRTLTTWHAIGVPSPPVPPSPDTTPSASSRDWANLSDGPAGLIS
ERLLAADVADYVSFRAACRPWRLCSTDPREHGVLDRRFHPRQWTMLRTKRGSPYRRCFMN
VSTGCCRYVHLPELRGHDVFGPTTEGLLVLLDRATCVVRLLNPFTRQAADLPPATALMTQ
RDLERRRDGGDLAEISGTFLADDCTIAVCFAGITTLAVAKPGDAQWAVVDRGTYLSPAMS
FAGRFYCATNRVVMVVETSADDHPPRLAVAAELSRPKLVPVRGLGGRAVFIGWERALSVS
PSVFPSISADTIYLGFNSLFGYMDDSPVHLMEVTSEPPFLGSEAYVQLLR
Download sequence
Identical sequences K4A348
Si033301m|PACid:19713914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]