SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033327m|PACid:19710375 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033327m|PACid:19710375
Domain Number 1 Region: 25-73
Classification Level Classification E-value
Superfamily F-box domain 0.000000000484
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 207-368
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000262
Family Galactose oxidase, central domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033327m|PACid:19710375
Sequence length 384
Sequence
MKKSALAPEHKPDKVDDAPLANDGVLPTDVLRDVLLRLPAKALCHRIRLVCRSWRLLTSD
PVFVQAHKFLHPLIAGLHEDQREIHIIDLHGNTIIRRIPVPRACNDLTTQLDVVCASAIK
EPSFVLEKGQREVSALPELQLVGDTTFFPSVLGYVPSTGEYKVLFFKLYCTNNHGHVQPC
HVISLNGGNRRWRVAPRPAVPVEPAPGNRAVIGGVAYFLMNPYNVNCPDDLEPDSIASFD
LEAEEWMPTPLRGPLSSLLSAGGDALSYKKHRHNFQLTELNGSLVIVHCKNRGRSMDIWF
LMDIDKAKGIWCKRYSMQCASEWEYNRRFYPVIILDDGRIVMWNRIGQIMRAYDPRTSTW
STVMGTGGGMYVAVGTYVVGSLLL
Download sequence
Identical sequences K4A374
Si033327m|PACid:19710375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]