SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033344m|PACid:19713330 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033344m|PACid:19713330
Domain Number 1 Region: 17-58
Classification Level Classification E-value
Superfamily F-box domain 0.00000000235
Family F-box domain 0.0031
Further Details:      
 
Domain Number 2 Region: 111-381
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00000222
Family Tricorn protease N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033344m|PACid:19713330
Sequence length 403
Sequence
MATMQLDDEEFETAVGTLPELPEDVLMSIFATLEIPDLLRAGSVCSSWRSAYTCLRNLGK
YKQSQTPCLLYTSQSAGENVACLFSLAENRTYKITLPEPPIRSRLLMGSSNGWLITADER
SDVHLVNPITGEQIALPSVITIEHVKPIFDDGSGTIDKYELSHHTAPNILRKYVNFNKAF
VFPDPSTGSYIVVLIHRPNFQLSFIRAGDDKWTWLPHGAGYCDCVYMDGLLYALKSSGEI
HAFDLTSSTVTMRVVIGSTRLGICDIMYIIQAPWGDLLQVWRTVDDTEKWGVRTLRVKVY
KVDVEAKGLVEINSLPNHVLFLGRNNSLCLSADGYPKLKSNHAYFTDDLDQVTTPVNNYT
RDIGVWDFKNRRKKVIVSRIWSSWPCPTWITPSLMKLNLAFSK
Download sequence
Identical sequences K4A391
Si033344m|PACid:19713330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]