SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033404m|PACid:19711338 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033404m|PACid:19711338
Domain Number 1 Region: 415-475
Classification Level Classification E-value
Superfamily GYF domain 0.000000000249
Family GYF domain 0.00084
Further Details:      
 
Domain Number 2 Region: 34-80,113-156
Classification Level Classification E-value
Superfamily F-box domain 0.000000000445
Family F-box domain 0.0069
Further Details:      
 
Weak hits

Sequence:  Si033404m|PACid:19711338
Domain Number - Region: 148-226
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.017
Family Galactose oxidase, central domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033404m|PACid:19711338
Sequence length 487
Sequence
MSESEPEHGPEGPEPEPIPPWPSPSSVSSVLENDDLITVILRHLPPRPSSLPRASLVCKR
WRSSATSESFLRDFRAFHRAAPPLLGLFHNSYLGGPDRRFVAAVDPPDRVPASPFRVPFG
RDHRRWRFLDCRHGRALLLGPAGPRHEVLVWDPMTGERRRAPLPPDAADVRHGAVLCSCG
HERDCRSSHFQVVLVWFKLLPSTHHRRALAAVYSSESGTWSPIITVQVPFMAAAGIATKP
GTLAGNGAVYWLLPGSRILEFDAVTRNLAAISVPACAAGCLYWQCQLVLTEAKELGFAMA
TEVGIMLWKRDSENACGWSMYRSVQLDGRLPPRKPMQEQASLLGFHEEGNAIFVWAEAGG
VFMIQLESMQSRLLCQGVRHFEIYPFAGFYTGDATARAHGDDDVDARRPMPRLSMDTLNM
WHYEDPQGDLHGPYPMVMLWRWSIDPGFVAGEDFRVWRTDETKEQAVLLTDAMRTTAQLL
GPSLEQS
Download sequence
Identical sequences K4A3F1
Si033404m|PACid:19711338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]