SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033407m|PACid:19711082 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033407m|PACid:19711082
Domain Number 1 Region: 20-59
Classification Level Classification E-value
Superfamily F-box domain 0.0000000275
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033407m|PACid:19711082
Sequence length 413
Sequence
DMDSPKTKRSSEVAVAACPPDDPLVEILSRLHAKPRFRFKCVSKGWRDLITDRLGCRKSP
QTLEGFFFLVDEIQSCSDDRSDYGCFIDLLGKPSPLIDFSFTFLTKVPEIDKMVLTGYCN
GLLLYGHRRSSDKYDTLGYVVCNPATEEWVAVPSSGWKPPPSPSLEGIEDEQYQVPILQG
EHVLTYMLFDPDTSPHFHLVEFWMKSFVELEGVHAYSSEIGVWRPNEGGSWGKSAIIGSS
LGSGCVFRGMLHFIVTCTFNVRWQRMIVAVDGEGKTSRTMRWPEDRGHLLFIGQTQGHLH
CISGHVDDSDHMNELSIWVLEDYGGEKWVLKHNVSVLQLFGKASCECDSYGVVEIHPKCN
MVFFFQYWNQKLISYDMDSKEVRDLYTLVRDDYESIMPYVPYYGSSLALAKKH
Download sequence
Identical sequences K4A3F4
Si033407m|PACid:19711082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]