SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033466m|PACid:19713727 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033466m|PACid:19713727
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily F-box domain 0.000000000196
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033466m|PACid:19713727
Sequence length 97
Sequence
MAPPLREEEGGDSAAVEASALRAPAHVMARVFSQLDCVDLLSCSLVCKQWYRDSAELREE
WRKEYLDAWNQFGLSVTREPQPLCPTCSLRSLRSLCP
Download sequence
Identical sequences K4A3L3
XP_004956654.1.39314 Si033466m|PACid:19713727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]