SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033873m|PACid:19683889 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033873m|PACid:19683889
Domain Number 1 Region: 36-116,161-291
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.23e-21
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 2 Region: 223-356,498-603
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000000144
Family Tricorn protease domain 2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033873m|PACid:19683889
Sequence length 1644
Sequence
MPEQTRSGAPMEWTTVQHLDLRHSGGRRGASARPMQPHAAAFRASQAIVAVAIGTHVVEF
DALTGSKIASIDLGTRVVRMAYSPTTSHVVIAILEDATIRSCDFATEQTLVLHSPEKKSD
HVSIDTEVHLALTPLEPIVFFGFHKRMSVTVVGTVEGGRPPTKIKTDLKKPIVNLACHPR
LPVLYVAYAEGLIRAYNIQTYAVHYTLQLAVDSTIKLMGAGAFGFHPTLEWIFVGDRGGT
LLAWDVSTERPSMIGITQAGSQPITSVSWLPTLRLLVTIAKDGSLQVWKTRVIINPNRQP
METHFFERAAIETMDITKILTLQGGEAVYPLPRIKNLAVHPKFNLAAVIFADMSGTEAAK
NKAAYTREGRRQLFALLQGARGSTAAVLKEKLLALGSSGILAEHQLQAQLQEQHLKGQSQ
LTISDVARKAFLHSHFMEGHAKSGPISRLPLVTISDSSNLLRDVPVCQPYHLELNFFNKE
NRVVQYPVRAFYLDGFNLMAHNLSSGTDNLYKKLYSTIPSNMECHPKNISYSPKQHLFLV
VFELSGPNGVAHEVVLYWEQTDLQTVNSKGSSIKGRDAAFLGPDDNQYAILEEDKTSLNL
FSLKAVATKEALENNAAVLEENTFADNAANSTERQGPLHFTFESEVDRIFSSPLESTLLY
VISGKHIGLAKLLQGYRLSTDNGLSITTKTDGKKFIKLKPNETVLQVHWQTTLRGPVVGI
LTTQRVLIASADLDILSSSSTKFDRGLPSYRSMLWVGPALIFSSATAISMLGWDNKVRSI
LSTSFPRSVLIGALNDRLLLVNPTDINPRQKKGVEIRSCLVGLLEPLLIGFATMQQHFEQ
KLDLSEVLYQITSRFDSLRITARSLDILAKGPPVCGDLAVSLSQAGPQFTQIMRCNYAIK
ALRFSTALSILKDEFLRSRDYPQCPPTSHLFQRFRELGYACIKYGQFDSAKETFEVIADH
ESMLDLFICHLNPSALRRLAQKLEESATDSELRRYLERILRVRSTGWTQGVFANFAAESM
VPKGPEWAGGNWEIKTPTNIKTIPQWELAGEVMPYMKTTDAGIPSVVADHIGVYLGVMKG
RGNVVEVSEKSLVKAIAAASSENAQPVSSESAEKNKAIAGGDSVGDTLARQLGVQIASSD
EQAKAAEEFKKTLYGVVDGASSDEDESTSKTKKIHIRIRDKPAASAVDVNKLKEATKQLG
LGPPLSRTRSLSGTPQEFNQAPTQPGGPAAAVSPAMPNTAIDLFGTNTLVQPQAPSGATG
PVIAGMGVTAGPIPEDFFQNTIPSHQLAARLPPPGIVLSRMAQPAPGMYQGPPVPNQNMM
ANVGLPDGGVPPQAPPQQSQFPQQPGIPMDNIGLPDGGVPPQSQPLPSQPQTLPSQPQGF
QPGIPTPSQPIDLSTLVEGPGAAKQAARPPAPTAVRPGQVPRGAPAAECYKMALAHLEQN
QLTDALSCLDEAFLALAKDQSREADIKAQATICAQYKIAVALLQEIARLQRVQGAGTLSA
KEEMARLSRHLASLPIQAKHRINCIRTAIKRNMEVQNYAYAKQMLDLLYSKAPPTKQDEL
KSLIDMCVQRGLTNKSIDPFEDPSQFCSVTLSRLSTIGHDVCDLCGAKFSALSAPGCVIC
GMGSIKRSDALAGGPGPAVPSPFG
Download sequence
Identical sequences K4A4R9
Si033873m|PACid:19683889 XP_012698175.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]