SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033919m|PACid:19679852 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033919m|PACid:19679852
Domain Number 1 Region: 79-351
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 3.01e-17
Family Tricorn protease domain 2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033919m|PACid:19679852
Sequence length 1333
Sequence
MRNLRLVTRLPQQLPLQLDGETLLASAVDAERRRAFFASSANFIYTVQLPASSTQGQEPL
PWSKISTQHSDVEEVVLEPGDCIVAMDYLMERESLLLGSSAGCLLLYNVEEKTTEVVGRL
EGGVNTIASSPDGALLSVTTGLGQLLVITQDWEVLFETSLDPQDATLGDIDSTGCQIRSS
ISWRGDGKYFATLGAPDGAYGPTKLTIWERESGKVHSSSDAKTFMGTSLDWMPSGAKVAT
IHDRRTEGKCPLIVFYEKNGLERSHFSIDEPAEVAIHALKWNCNSEILAALVSSGQHDVI
KIWSCRNNHWYLKHELRYTKEERVKFFWDPTKPMHLICWTLGGQVVIHRFAWTTAVSETS
VALVIDGSHILVTPLHLGLMPPPMSLFQLAFPCAVNEVSFVSSNSKTQLAAYLSNGNLCA
VELPAPDTWEEFEGSRISVDPCSSDFTLDNCMHLAWIDTHTLLGICCYSEHYCSTPIGSI
EASNLVDKHDSLFSINEIGLVCSEDFVPGSVSSSGWQARVSKKVPLQSSVIGISPNPAKK
GSAFIQISGGRIVEYCSSLNLSKMCVPAQISEVDSDHGFPASCPWMTAVLCHENGIAQPF
LFGLDDNSKLYMGKRLLSDNCSSFTFYSSAYGTTERVMSHLLVTTKQDLLYIVDVNKIFL
KDNEVTIDSHASSHPRGKQSKEHITVWEKGAKLVGVLHGDEAAVIMQTIRGNLECTYPRK
LVLVSIVQALAQRRFKDAMDMVRRHRIDFNIIVDYCGCDVFIKLAADFVKQVNNLSHITE
FVCSMKNDNVSSKLYEAYISFPDQSAVPMVDIECTPGFLGNKVTSVLMAVRKALEEQIEE
SSSRELCVLTTLARSEPPLLEEALNRIKVIRELELRGLDDAKRKLYPSAEESLKHLLWLT
DTEAVFGAALGLYDLNLAAIVALNSQKDPKEFLPFLKSLECLPPAIMRYTIDLRLGRYES
ALRNVVSAGNEYHEDCMKLLNSNPQLFPLALQLFNKPDKRNEILEAWGDHLSEEKCFGDA
ALTYQCCSSYQKSLKAYRACGDWKGVFTVAGLLELEKEEITQLAHELCDEFQALGKPGDA
ARVALEYCSDAERGVNYYIMAREWEEALRVAYMLTRHDLVGTVRDAASECAVSLISEYQE
GLLKVGKYIARYLAVRQRRLSLAAKLQSEDRFMDVEDDSISEVSTSFSEMSAYTTRSTKE
STASVISSKASKSRGARRQKKGGKIRAGSPGEEMALVEHLKGMALTGSAENELKSLLVVL
IQLGKEESARQVQQAADNFVVSQTAAVKLAEDTVCNDKVDENAHTLEHYVRMLRAHGSGH
SETGSWRIKALSP
Download sequence
Identical sequences K4A4W5
Si033919m|PACid:19679852 XP_004982448.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]