SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033947m|PACid:19681344 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033947m|PACid:19681344
Domain Number 1 Region: 539-639,887-1070
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000256
Family WD40-repeat 0.032
Further Details:      
 
Domain Number 2 Region: 41-214,318-383,564-637
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000275
Family Tricorn protease domain 2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033947m|PACid:19681344
Sequence length 1230
Sequence
MYLYSLTLQRATGAVCAVIGSFSGRDTKKSAASGSASTQEIAVARGSTLDLLRPDPETGR
LRTLLSVDVFGAIRSLAQFRLTGATKDYLVVGSDSGRLVILEYSPDRNRFDKVHQETFGK
SGCRRIVPGQLLAVDPKGRALCIAALEKQKLVYVLNRDAAARLTISSPLEAHKSNTLTFS
LTALDCGFDNPIFAAIELEYAESDRDPTGQAANQAQKLLTFYELDLGLNHVSRKASEPID
NGANLLVTVPGGGDGPSGVLVCCDNFVLYRNQGHPEVRAVIPRRADLPAERGVLIVAAAT
HRQKNLFFFLLQTEYGDIFKVDLEHSGETVTELRIKYFDTIPVTSATCVLRSGFLFAASE
FGNHALYQFRDIGRDADVESSSATLMETEEGFQPVFFQPRPLKNLMRIDEIESLMPVMDM
RVANLFDEETPQLFTACGRGPRSTLRILRPGLAISEMARSMLPAEPIAVWTVKKNINDMF
DAYIVVSFANVTLVLSIGETIEEVSDSQFLDTTHSLAVTLLGEDSLMQVHPSGIRHIRED
GRVNEWRTPGKKTITKVGSNRLQVVIALSGGELIYFEMDMTGQLMEVEKQDMSGDVACLA
IAPVPEGRQRSRFLAVGSYDNTIRILSLDPDDCLQPLSVQSVSSAPESLLFLEVQASVGG
EDGGDYPANLFLNAGLQNGVLFRTNVDMVTGQLSDTRSRFLGLRPPKLFPCMVSHRQAML
CLSSRPWLGYIHQGHFLLTPLSCDTLESAASFSSDQCSEGVVAVAGDALRIFTIERLGET
FNETAIPLRYTPRKFVILPKKKYIAVIESDKGAFSAEEREAAKKECLEASGAAENGNANN
GDPMENGDGQEDGAEEGNTFPDEQYGYPKAESERWVSCIRILDPRSRDTTCLLELQDNEA
AVSICTVNFHDKEHGTLLAVGTAKGLQFWPKRTLAAGFIHIYKFVSDGRSLELLHKTQVE
EVPLALCQFQGRLLAGVGSVLRLYDLGKRKLLRKCENKLFPKTIVSIHTYRDRIYVGDMQ
ESFHYCKYRRDENQLYIFADDSVPRWVTAAQHIDFDTMAGADKFGNIYFARLPQDISDEI
EEDPTGGKIKWEQGKLNGAPNKVEEIVQFHVGDVVTSLQKASLIPGGGECLIYGTVMGSV
GALLAFTSREDVDFFSHLEMHLRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQYPSLP
ADMQRKIADELDRTPGEILKKLEDIRNKII
Download sequence
Identical sequences K4A4Z3
Si033947m|PACid:19681344 XP_004985871.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]