SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034193m|PACid:19684859 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034193m|PACid:19684859
Domain Number 1 Region: 313-699
Classification Level Classification E-value
Superfamily ARM repeat 2.78e-51
Family Armadillo repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 34-248
Classification Level Classification E-value
Superfamily RNI-like 5.49e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily F-box domain 0.000000278
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si034193m|PACid:19684859
Sequence length 873
Sequence
MLQLFARLNYRDRASMAAACRAWRALGSSPCLWSELDLRAHRCDREMASSLAERCGSLRR
LRLRGHEAVEAVPGLRARGLREVVADGCRGLTDAALAVLAARHEDLERLQIGPDPLERIS
CDALRQVALCCSKLRRLRLSGLREADAGAVGALARYCPLLEDVAFIDCGAVDEAALADIH
SLRFLSVAGCRSLKWATASTSWTQLPSLIAVDVSRTDVPTNAISRLISNSKTLKLICTLN
CISVEEELVQDPSVFSNSKGKLVLTVKSHIFKSIATIFPGVDVKEHEVFNQCNWRYNDNI
AGDTMTWLEWILSQSLLRIAETNPQGMDEFWLLQGTALLLRLLKSSQEDVQERAATALAT
FVVTDDESANVDPARSEAVMQNGGIRMLLDLARCSRESAQSEAAKAIANLSVNTKVAKAV
ADEGGITILTSLAKSMNRLVAEEAAGGLWNLSVGEDHKAAIALSGGIKALVDLIYRWSAG
TDGVLERAAGALANLAADDKCSLEVAKAGGVHALVTLARSCKHDGVLEQAARALANLAAH
GDNNDNNAAVGQEAGALEALVQLTGSENEGVRQEAAGALWNLSFDDRNREAIAAVGGVEA
LVSLVQQCLNGSEGLQERAAGALWGLSVSEANSIAIGQGGGVAPLLTLARSEVEDVHETA
AGALWNLAFYSGNALRIVEEGGVPVLVSICSSSGSKMARFMSALALAYMFDGRMDEVALV
GTSSDSSSKSVNVEGARRIAFKHIETFVLTFSDPQMFSVAATSSAPAALSQVAELVFIHE
AGHLRCSGAEIGRFVAMLRNPSLILRACAAFALLQFTIPGGRHAVHHAGLLQKAGAGRVL
RAAAAATSASIEAKIFARIVLRNLEHHQSGTST
Download sequence
Identical sequences K4A5N9
Si034193m|PACid:19684859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]