SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034200m|PACid:19684860 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034200m|PACid:19684860
Domain Number 1 Region: 313-697
Classification Level Classification E-value
Superfamily ARM repeat 1.29e-49
Family Armadillo repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 34-248
Classification Level Classification E-value
Superfamily RNI-like 5.49e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 3 Region: 2-49
Classification Level Classification E-value
Superfamily F-box domain 0.00000245
Family F-box domain 0.0069
Further Details:      
 
Weak hits

Sequence:  Si034200m|PACid:19684860
Domain Number - Region: 677-709,786-820
Classification Level Classification E-value
Superfamily ARM repeat 0.0152
Family PBS lyase HEAT-like repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si034200m|PACid:19684860
Sequence length 871
Sequence
MLQLFARLNYRDRASMAAACRAWRALGSSPCLWSELDLRAHRCDREMASSLAERCGSLRR
LRLRGHEAVEAVPGLRARGLREVVADGCRGLTDAALAVLAARHEDLERLQIGPDPLERIS
CDALRQVALCCSKLRRLRLSGLREADAGAVGALARYCPLLEDVAFIDCGAVDEAALADIH
SLRFLSVAGCRSLKWATASTSWTQLPSLIAVDVSRTDVPTNAISRLISNSKTLKLICTLN
CISVEEELVQDPSVFSNSKGKLVLTVKSHIFKSIATIFPGVDVKEHEVFNQCNWRYNDNI
AGDTMTWLEWILSQSLLRIAETNPQGMDEFWLLQGTALLLRLLKSSQEDVQERAATALAT
FVVTDDESANVDPARSEAVMQNGGIRMLLDLARCSRESAQSEAAKAIANLSVNTKVAKAV
ADEGGITILTSLAKSMNRLVAEEAAGGLWNLSVGEDHKAAIALSGGIKALVDLIYRWSAG
TDGVLERAAGALANLAADDKCSLEVAKAGGVHALVTLARSCKHDGVLEQAARALANLAAH
GDNNDNNAAVGQEAGALEALVQLTGSENEGVRQEAAGALWNLSFDDRNREAIAAVGGVEA
LVSLVQQCLNGSEGLQERAAGALWGLSVSEANSIAIGQGGGVAPLLTLARSEDVHETAAG
ALWNLAFYSGNALRIVEEGGVPVLVSICSSSGSKMARFMSALALAYMFDGRMDEVALVGT
SSDSSSKSVNVEGARRIAFKHIETFVLTFSDPQMFSVAATSSAPAALSQVAELVFIHEAG
HLRCSGAEIGRFVAMLRNPSLILRACAAFALLQFTIPGGRHAVHHAGLLQKAGAGRVLRA
AAAATSASIEAKIFARIVLRNLEHHQSGTST
Download sequence
Identical sequences K4A5P6
Si034200m|PACid:19684860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]