SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034646m|PACid:19679045 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034646m|PACid:19679045
Domain Number 1 Region: 309-571
Classification Level Classification E-value
Superfamily RNI-like 4.32e-32
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 2 Region: 69-294
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000322
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Domain Number 3 Region: 12-93
Classification Level Classification E-value
Superfamily F-box domain 0.000000602
Family F-box domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si034646m|PACid:19679045
Sequence length 638
Sequence
MTPPLPPDPIEPCPPPMDAALPAAVVATILSRLDVRSLLLAAAACRGLRTCASHALAFLP
SFHLLEVALTHDLLRPLLPPNPSLRSLRLDCARLEDDAIGCLARSSLHELLLLNCDNISG
RLLCELGATCRDLRVLSLNSLGERRGLVVNFSDLQELLNGCSQLESLRLELDFSTFDDPN
FGHVWASASQRLSSLEIGYIPMIMLLEFLTAVVEARQHMDYVKAPVFFPSLQKLCLTVDF
ITDHLIGSISVALPSLTHLDLQDAPIIEPTSASDLTNAGLQQINPHGKLKHISLMRSQEF
LVTSFRRVNDLGILLMADKCSNLESVCLGGFSRVTDTGFRAIIHSCSGLHKLRVSHGSHL
TDLVFHDIIATSLCLTHVSLRWCKLLTDVGIERLSFNKDLNVLDLRDCRSLGDEAVRALS
CLPKLQTLSLDGTDISDEALKYLGLGTCPLTSLSLRGCRKLTNDCIPLLFAGSVKQSLQV
LDISRIPSVTDDGIMLLARSRTPLIELRMRENSKIGDAAVMALASMQVDGGTHGSSLQLL
DLYDCGGITPLATRWFKKPYFPRLRWLGITGSLNRVMVDALARSRPFLHMACRGEELGTM
LWDTYSDWYRHNDDDMDELEQWLLDGEPVSDDDTIMEE
Download sequence
Identical sequences K4A6Z0
XP_004985805.1.39314 Si034646m|PACid:19679045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]