SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034796m|PACid:19682923 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034796m|PACid:19682923
Domain Number 1 Region: 87-239,296-402,461-559
Classification Level Classification E-value
Superfamily RNI-like 1.96e-27
Family Rna1p (RanGAP1), N-terminal domain 0.061
Further Details:      
 
Domain Number 2 Region: 26-54
Classification Level Classification E-value
Superfamily F-box domain 0.0000458
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si034796m|PACid:19682923
Sequence length 597
Sequence
MSEEDEDQPPPKRPSASPPADQVLGNVLETVLQFLDAPRDRSAASLVCRSWHRAESATRE
AVAVRNLLAASAARTARRFPNARTLLLKGRPRFADFNLLPHGWDASAFRPWAAAIAAGAF
PALASLYLKRIPVTDADLDLLSRSLPASFRDLSLHLCDGFSSRGLASIASHCRALRVLDV
VECDMAEEQEVVDWVAAFRPEPTNLESLSFECYEQPVSFAALEALVARSPRLTRLGVNQH
ISLGQLRRLMAHAPRLSHLGTGSFRPADGGEEGVGFGEVLAAFDSAGRARTLVSLSGFRE
LAQEYLPTITVVCSNLKSLDLSYTPVTPNQILMFIGQCYNLETLWVLDSVRDEGLGNVAI
SCKKLKCLRVLPLNAHEDADELVSEVGLTAISQGCPELRSILYFCQTMTNAAVIAMSRNC
PELKVFRLCIMGRHQPDHATGEPMDEGFGAIVQNCSKLTRLSTSGHLTDRAFEYIGRYGK
SLRTLSVAFAGNSDVALQYILQGCSKLEKLEIRDCPFGDAGLLSGMHHFYNMRFVWMSGC
NLTLQGCKEVARGLPRMVVELINGQPENERTEKVDILYMYRSLDGPREDVPSFVKIL
Download sequence
Identical sequences K4A7E0
Si034796m|PACid:19682923 XP_004985419.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]