SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034821m|PACid:19679552 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034821m|PACid:19679552
Domain Number 1 Region: 103-243,277-358,456-537
Classification Level Classification E-value
Superfamily RNI-like 3.92e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.048
Further Details:      
 
Weak hits

Sequence:  Si034821m|PACid:19679552
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily F-box domain 0.00741
Family F-box domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si034821m|PACid:19679552
Sequence length 590
Sequence
MGGEVEGGGGRQLGRVLSFGIPDTALGLVMGYVEDPWDRDAISLVCRHWCRVDALSRKHV
TVAMAYSTTPERLFRRFPCLESLKLKAKPRAAMFNLISDDWGGSASPWIRQLSATFHFLK
KLHLRRMIVSDDDISILVRAKAHMLVSLKLDRCSGFSTPSIALVARSCKKLETLFLEEST
IAENENDEWIRELATNNSVLETLNFFLTDLRASPEYLTLLVRNCQMLKTLKISECLMPDL
TGLFRTAQTLQEFAGGAFEEPGQQVANRNYENYYFPPSLHRLGLHYMGANEMQILFPYSA
ALKKLDLQFTLLNTEDHCQIVQRCPNLEVLEARDVIGDRGLQVVAQTCKKLQRLRIERGD
DDHGGLEDEQGVISQVGVMAVAQGCPELTYWAIHVSDITNAALEAVGTFSRNLNDFRLVL
LDREAHITEFPLDNGVRALLRGCTKLRRFAFYVRPGVLTDVGLGYVGEFSKSIRYMLLGN
VGESDNGIMQLSRGCPSLQKLELRGCVFSEHALAMAALQLKSLRYLWVQGYKASPTGADL
MAMVRPFWNIEFIAPDQDGPCPDIKKQILAYYSLAGRRTDCPPSNPKTKH
Download sequence
Identical sequences K4A7G5
Si034821m|PACid:19679552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]