SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034985m|PACid:19684367 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034985m|PACid:19684367
Domain Number 1 Region: 176-428
Classification Level Classification E-value
Superfamily RNI-like 2.55e-19
Family 28-residue LRR 0.06
Further Details:      
 
Domain Number 2 Region: 127-174
Classification Level Classification E-value
Superfamily F-box domain 0.0000301
Family F-box domain 0.0078
Further Details:      
 
Weak hits

Sequence:  Si034985m|PACid:19684367
Domain Number - Region: 455-532
Classification Level Classification E-value
Superfamily L domain-like 0.0782
Family mRNA export factor tap 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si034985m|PACid:19684367
Sequence length 557
Sequence
MGVADPKPPPRPKTRGNYNCGRCGQPKKGHVCVAPVPVAAPSGGGAPSPSPSTSSGAASA
SGGGGGGEQRLRRALSFDEAGTPSSPEKKPKVEGDVEMDVAGGEGEMEEGGDEDDDAAVE
VGGRPVPGEVMAEVLRRLGPRGVMAAAGVNRGWRDCAGRVWRAADELRLRVLASTGAGLL
GALLPRCPALSRLDLRMERDVDATTLACLAFSCPSLKTLEITMAANAINRMTGEDLSRFV
SEKSSLSVLKIGGCSNLDFINLCSSSLSVLWLSELCSLSKSVMNCPNMSELSLCFAQQSN
DCTDMVSLMDAMGRTCPNLNKMHISSNQLSNEAVFALESANLRGLCMLSLILGSKITDAA
VASIVRLCTSLELLDLSGSSISDNGVGMICKAFPHTLSRLLLALCPNVTTRGIQLATAQL
PHLQLMDCGMSLCANLNNEKGPMFGDINGGIRIIRKLCASKNQPIHQKLIIKHGNLKKLS
LWGCSAIDALYVNCPELNDLNLNSCTNLHPERLVLQCPNLKNVHAVGCQDMLIGAIRNQV
NQTLITCKPQNLNKQII
Download sequence
Identical sequences K4A7X9
Si034979m|PACid:19684366 Si034982m|PACid:19684368 Si034985m|PACid:19684367 XP_014660070.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]