SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035019m|PACid:19681866 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035019m|PACid:19681866
Domain Number 1 Region: 223-415
Classification Level Classification E-value
Superfamily L domain-like 0.000000019
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 43-85
Classification Level Classification E-value
Superfamily F-box domain 0.0000000419
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035019m|PACid:19681866
Sequence length 550
Sequence
MASDSETPARRYRRLRKASDLPTVAAASPCKRMRAGKEYNSYEDRISTLPEEILLIIVRK
LDTRTTITTIILSKRWRDLPRCLPTSYNLAADDLLPPRYHRLKRLTIEAKAAYEAEKNVH
KLTDIYAIKARHERWMTKIRPLTAILERYERRAMRRYVKQVNAFLLAPKDVRQRRPVQKL
RLQMLGRWHQNIDEWITTAIAKWDVEDFELVVDGYCLYYDLKQLDAYRNLRLKRLALSNC
QGICAWNCLTAKRLTKLSLGEASYIGLVNDILANCVQLTDFRVASSSFYRAKFLIFAPSS
KLKNLQVDRCNFGKICLISLPCLETFVCRGRPTKLSYGEVPQLRRVSLDYLQTEDNDIDD
ESGSRRTYPPSKFFKRTPQLDCLVLQFKGTQMWIEPFAVLSEFSQLKKLFIANVPANWDV
LWILLLLDATPALESFHVHIDNSSEERSAGDLCASLDVGARQDRYRRLKELVVAGFEGLG
WQTSFVRLIMKRSPLLRRVHLLDGHVRDDEQELGALQIVPHRREWHECEWAEVLDDLTAG
FRWPPQIILE
Download sequence
Identical sequences K4A813
XP_004981467.1.39314 Si035019m|PACid:19681866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]