SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035022m|PACid:19685279 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035022m|PACid:19685279
Domain Number 1 Region: 223-414
Classification Level Classification E-value
Superfamily L domain-like 0.0000000218
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 42-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000000419
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035022m|PACid:19685279
Sequence length 549
Sequence
MASETHPSRHRRLRKASDLSTVTTASPLSKRIRMGKKDDSYEDRISTLPEEILLIIVRKL
DTRTTITTIILSKRWRDLPRCLPTSYNLAADDLLPPRYHRLKRLTIEAKAAYEAEKNVHK
LTDIYAIKARHERWMTKIRPLTAILERYERRAMRRYVKQVNAFLLAPKDVRQRRPVQKLR
LQMLGRWHQNIDEWITTAIAKWDVEDFELVVDGYCLYYDLKQLDAYRNLRLKRLALSNCQ
GICAWNCLTVKRLTKLSLGEASYIGLVNDILANCVQLTDFRVASSSFYRAKFLIFAPSSK
LKNLQVDRCNFGKICLISLPCLETFVCRGRPTKLSYGEVPQLRRVSLDYLQTEDNDIDDE
SGSRRTYPPSKFFKRTPQLDCLVLQFKGTQMWIEPFAVLSEFSQLKKLFIANVPANWDVL
WILLLLDATPALESFHVHIDNSSEERSAGDLCASLDVGARQDRYRRLKELVVAGFEGLGW
QTSFVRLIMKRSPLLRRVHLLDGEVRDDERELGALQIVPRRREWHECERAEVLDDLTAAF
RWPPQIILE
Download sequence
Identical sequences K4A816
XP_004981468.1.39314 Si035022m|PACid:19685279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]