SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035225m|PACid:19681625 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035225m|PACid:19681625
Domain Number 1 Region: 180-443
Classification Level Classification E-value
Superfamily L domain-like 0.000000000442
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.059
Further Details:      
 
Domain Number 2 Region: 41-93
Classification Level Classification E-value
Superfamily F-box domain 0.0000000288
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si035225m|PACid:19681625
Sequence length 515
Sequence
MSMERQPDRWRRQVQAPDGLITSRAKSKGSPCLQDDDSQSGEIQIYSGPSLPEDILCHIH
SLMPMRDAAQAACVSRAFLHSWRSHPNLDFSKKTLGSNKKTYGNGEVARDFSSKVDHILR
KHSGIGVKKLKIHMPKFCNAKDSCYLDSWLQIAVIPGIEDLVLALSWRAKYNFPYSLLSN
GSGDSIRSLHLAGCSFRPTSELGGLRTLTRLHLRDVCIKGGELGSLLSSSLTLEQLEIMY
CDGIVCLKVPCLLQRLSDLKVFECRTLRVIDSKAPNISRFSFTGDHRVKLSLGEALQMNN
LHMYFSGAVHYARVELPSSMPNLETATIYSGSEIVDTPMLHSKYAHLKNLSIALRAFTFP
PTYDYFSLASFFDACPSLEIFLLDVSQRKMEHVSILGDPSGLRHLRGQHHHKIKSVKILG
FTSSKSLVELTCHVVENITSLELLTLEAHQSTVRCSVPAHNCRKCSPLPIDVLMEAERAL
FAIRAFIEPKVSSKVKLNIVEPCRQCHAAELARLG
Download sequence
Identical sequences K4A8L9
Si035225m|PACid:19681625 XP_004984370.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]