SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035497m|PACid:19684342 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035497m|PACid:19684342
Domain Number 1 Region: 330-381
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000406
Family F-box domain 0.0035
Further Details:      
 
Weak hits

Sequence:  Si035497m|PACid:19684342
Domain Number - Region: 19-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000911
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035497m|PACid:19684342
Sequence length 473
Sequence
MKLRLRSMEARGGAAAVETHRVDLPPTATLGDVKTLLAAKLSALPVPAESVRLSLNRSEE
LVSPDPAATLPALGLASGDLVFFALSPLTALAPPAQALPRNPSPGSGSVPTAMAVDGGKG
SEKPSTGGSSLQARAVVVNPSVPAASSPADVVMAETVDATKGWSSFVLRDLKREMGNVVG
AEGTAGGRLVAALHAALLEFGFHITNPMGSRLSLPPDWPPVASKPLAIKYTIPELSPMLH
VAEEGKVAVLNFSLMPNFVIVYGYVPGAQSEVRRLCLELPRLEPLLYLDSDQLSAVQERG
ILDLWTVLKDEMCLPLMISLCQLNGLRLPPCLMALPADLKSKVLDLLPGDDLARVECTCK
EMRNLAADDSLWKKFVQFRNSGEGPRGSMSAKAIFAEAWQANKKRQKRPHPTFWNYGWGN
NPYSHPLRLPLIGGDSDRLPFIGNQGSVGRNFGNQRRNIVPNCILDGHRHNFL
Download sequence
Identical sequences K4A9E1
XP_012698403.2.39314 Si035497m|PACid:19684342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]