SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035640m|PACid:19684865 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035640m|PACid:19684865
Domain Number 1 Region: 40-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000144
Family F-box domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035640m|PACid:19684865
Sequence length 454
Sequence
MDASSKSWIVISWNLSIHKKNLCSFRNDEYLQQPLMEVAARDFSELPQEILMDIFSLMET
PDLVRAGSVCCSWNLSYASICRFGLYKWPQTPCLIYTSESAGDNIAFLYSLAEKRTYKLT
LPEPPIHRRYLIGSSLGWLITADERSEMHLVNPVTSEQIPLPSVITIENVTPIYDETGVI
CKYHLSRHMAGHAQVLPSTSLLRKLRDFLFLKAFLFYDESARSYIVVLIHAPVGRLSFAR
LRDEKWTRLPPHENFDDCIYKDGLLYAVTLLGQIIAFDLSGTVVTTKIIMDRKDKYGVER
VYIVQAPWGDLLLVRRPEVWIDEAPAEHGHACTNQETFENRTRRIVIYKVCIASGKLEQI
NSLNDHVLFLGQNQSLCLNAEEYPQLKPNNVYLTDDAKNVSMKRRSRCRLIIGILDLETK
IMDEIVSPRPWSNCMAPLLIIPNPRKMDPPPPPP
Download sequence
Identical sequences K4A9T6
Si035640m|PACid:19684865 Si035642m|PACid:19684864 XP_004985753.1.39314 XP_004985754.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]