SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035724m|PACid:19681282 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035724m|PACid:19681282
Domain Number 1 Region: 167-440
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-48
Family Kelch motif 0.00057
Further Details:      
 
Weak hits

Sequence:  Si035724m|PACid:19681282
Domain Number - Region: 102-168
Classification Level Classification E-value
Superfamily F-box domain 0.0719
Family F-box domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si035724m|PACid:19681282
Sequence length 443
Sequence
MDLCDKREDMALQDGDSCLAPRPLRGGCEMESPWAEGLLQGGSRKRSAPEESEDDVQEID
EVDCGGKRSKPPSPQPHTPDIREAHAPGRRRTVAAGGGDQSNGGGDLIGEIGRDLSINCL
LRLSRSEYGSVASLNRDFRSLVRGGEIYRLRRQNNISEHWVYFSCNVLEWDAYDPYRERW
ISVPKMPPDECFMCSDKESLAVGTELLVFGMAHIVFRYSILTNSWTRGEVMNSPRCLFGS
ASVGEKAYVAGGTDSLGRILSSAELYNSETHTWTPLPSMNRARKNCSGVFMDGKFYVIGG
VTNNNMILTCGEEYDVQSKSWRVIENMSVGLNGVSGAPPLISVVKNELYAADYSEKDVKK
YDKQNNKWVTLGKLPERSVSMNGWGLAFRACGERLIVIGGPRTSVGGMIELNSWIPDDKP
PVWNLIARRPSGNFVYNCAVMGC
Download sequence
Identical sequences K4AA18
Si035721m|PACid:19681281 Si035724m|PACid:19681282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]