SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035801m|PACid:19684060 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035801m|PACid:19684060
Domain Number 1 Region: 24-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000000549
Family F-box domain 0.011
Further Details:      
 
Weak hits

Sequence:  Si035801m|PACid:19684060
Domain Number - Region: 114-165
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.0201
Family alpha-subunit of urease, catalytic domain 0.01
Further Details:      
 
Domain Number - Region: 154-233
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0575
Family Galactose oxidase, central domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si035801m|PACid:19684060
Sequence length 430
Sequence
MAEPAALEPEPRQADAAAFFRDSPPRVIIEIFRRLPARSILRLRSVCTVLRDVTSYRPLL
AAVHLLHPPQPLICFGRNACPDRYIQLRDYCVEALDLRSDTLRPIFRFTDNEYYNDIAND
EGFEPPPIFVFSKDNIHYGEMDGDGGGHDPRLMVHASIDGLLLVSFINSWYVCNPATRQW
AALPDLRDCDVIGLYEHVSSGEYRVLYHTGKDDEEASTCYYVLTVGAQEARSIGCPISPA
ATEDVGLDIGLDPASLSPPVQLRGSLHWPPQERQGHHILVFDTEAEVFSWKTAPNPITNG
RMQLLEMDHKLAMSVSKNGKPTLQLWRLEDYSNDIWVQIRRITIQVPRIPALQYIDWFPR
VVSPEGDVLIECENKLVLHCDRIGNLLQKFQFREETPLVRHTLKETLLPHAIFLAPKPDD
AIEPPFFQGL
Download sequence
Identical sequences K4AA94
Si035801m|PACid:19684060 XP_004987036.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]