SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035825m|PACid:19680988 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035825m|PACid:19680988
Domain Number 1 Region: 151-424
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-50
Family Kelch motif 0.00038
Further Details:      
 
Weak hits

Sequence:  Si035825m|PACid:19680988
Domain Number - Region: 84-144
Classification Level Classification E-value
Superfamily F-box domain 0.00187
Family F-box domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si035825m|PACid:19680988
Sequence length 427
Sequence
MLEGKSYLVSRSVPSSCEAETEWAYLANEVLSGKRPAPEDVGVEGLDEADGGGKRSKPPS
PQPHTPDITEGHGSSRHASGGKEQQATGSNPIHSIGRDLTINCLLRLSRSDYGSVASLSR
DFRSLVRSGEIYRLRRQNGVAEHWVYFSCNVLEWDAYDPYRDRWIRVPKMPPDECFMCSD
KESLAVGTELLVFGMARIVFRYSILTNSWSRADAMNYPRCLFGSTSVGEKAFVAGGTDSL
GTILSSAEMYDSENHTWTLLPSMNRARKMCSGVFMDGKFYVIGGVANNNKVLTCGEEYDL
KRCSWRIIENMSEGLKGVTGAPPLIAVVNNELYAADYSEKDLKKYDKKNNKWITLGKLPE
RSVSMNGWGLAFRACGDRLIVIGGPRTYTGGTIELNSWIPNDRPPVWNLIARRPSGNFVY
NCAVMSC
Download sequence
Identical sequences K4AAB9
XP_004985535.1.39314 XP_004985536.1.39314 XP_004985537.1.39314 XP_004985538.1.39314 XP_004985539.1.39314 Si035825m|PACid:19680988 Si035826m|PACid:19680989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]