SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035848m|PACid:19681614 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035848m|PACid:19681614
Domain Number 1 Region: 34-79
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000249
Family F-box domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035848m|PACid:19681614
Sequence length 422
Sequence
MPPSFVVRRKRSRSPPRGFDSARRTRTRPVPETERAGEDGKSAPALLPDDMLLEVFKRLP
PPRDVVRCAAVCRRWRRLVAGAGAACLPAPPHHFGFFLNYGPSPLPPFVPTAGVALGVGS
LPVPPACGAVLADSRGRRLLLRELGPASARELRLLVCSPLEKTHVRVPSLYTAGHRVACS
VLVPGEGSAFRVVVVLFGADPNHFEVLVYSSASSCWEAATGPVNREVVVRRGPSVVIGDV
VYKLQVEDKYIMVVEAVKMKLSAVPLPNTGTKLYDGNHWIGKTADGRLCFFAMREQLTLV
KWVLEAPGMWAEQQHVNLRASMHPALVGDLAQMKLSAKMSDQLRGCKLVSFAAFCEATGT
LFFVMADWVVALDRTTGRLQRLWRNADVSRPLGDVYPCEMLQWPPVLKDLGEAHDHKAGG
VC
Download sequence
Identical sequences K4AAE1
XP_004981904.1.39314 Si035848m|PACid:19681614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]