SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035942m|PACid:19681880 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035942m|PACid:19681880
Domain Number 1 Region: 22-72
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000628
Family F-box domain 0.0086
Further Details:      
 
Domain Number 2 Region: 88-199,288-381
Classification Level Classification E-value
Superfamily Kelch motif 0.00000222
Family Kelch motif 0.02
Further Details:      
 
Weak hits

Sequence:  Si035942m|PACid:19681880
Domain Number - Region: 182-272
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0541
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si035942m|PACid:19681880
Sequence length 406
Sequence
MELAMVEAPSPANGRKRKSPRSSSGLGDLHDDMLERVLARLPPASYFRLRAVCRRWRAAA
ASPTFLDACARVPSRDPWFLMLSGSDGASPVVAFDAAERGWNHCRAAPGSMPVAASGGLV
LYRSPATGALTIANPLTGASRALPPPPQQQGGRPLQAIAMYGGAPYRVALFTGELPDLSM
VVFDSSSNSWEGPVPLFRRSEDSSCPDAPGQAGDDDTVYFLSKSGDVVATNMQRSASKQY
SSVVVPSPARGEEGAVAYFLSHSGTVVACDTARRTFRELPRILPVYFEYSIDVVACGGAA
YAVVLSEYLDTASLRVWEFAGGAWRQVAAMPPAMSHGFHGKRADINCVGHGDRLMVCVSS
GEANGCFMCDVASNRWEELPKYVDGDGEANEFLAAFSFEPRVEITV
Download sequence
Identical sequences K4AAN5
Si035942m|PACid:19681880 XP_004984090.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]