SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035951m|PACid:19679917 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035951m|PACid:19679917
Domain Number 1 Region: 21-85
Classification Level Classification E-value
Superfamily F-box domain 0.00000249
Family F-box domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035951m|PACid:19679917
Sequence length 405
Sequence
MQSPSKFSSGSASTTTPAACRLQGWADLPEGLLQSIIPLLGSFLELLALAATCRSWRSAF
SSYPSKSTFCTLLPPLLVRPHIKVRAPHLPSRSDDSVKLRTCQVLDLANLRTALRCQIPK
ETFEMLHFAGSSYGQLICGGGRNCVVVDVFTGAKVLPPQLPLRFSEDTYFFSGMLTAPLT
SHNAHLVVCAALKQGSTQRSLLDWPVGSDSWSELWLNGSRIEQIVEFNGQFIALDYKYRL
HTLSLAPQLGLQEIATVWWDDMDECPYLRPWLVVCGDMLLIVDHYIILSFDGAPVNYKAY
RLDMSTVPAVWVEVEKLENHVLFIGSDVRSPAFSCVSPGRWGKRNNCLYYAYYDVPWVLH
GLGDEADAVWDPDNDDDIVFKRNWYTQLQPFWVYPSMFYADADGK
Download sequence
Identical sequences K4AAP4
Si035951m|PACid:19679917 XP_004984232.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]