SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035997m|PACid:19685543 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035997m|PACid:19685543
Domain Number 1 Region: 99-400
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 4.45e-100
Family Transcriptional factor tubby, C-terminal domain 0.00000452
Further Details:      
 
Domain Number 2 Region: 39-92
Classification Level Classification E-value
Superfamily F-box domain 0.00000432
Family F-box domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035997m|PACid:19685543
Sequence length 400
Sequence
MSFRSLIQDMRDEFGSISRHTLRSRSHRSAGNASRAAVAEPSEAMDQSCWAQLPPELLRE
VLVRIEASESWWPARKDVVSCAGVCRTWRGIMKEAVCVPEVSGKLTFPISLKQPGPRDGT
LKCFIRRNRTTQTYYLYIGLTEALADDGKFLLAARKCRKPTCTDYLISLDKVDMSKGSST
YIGKLRSNFLGTKFTVYDAHPPYDGAVVSKSRSARVVGLNQVSPRIPAGNYPVSHISYEL
NVLGSRGPRRMNCVMDSIPASAVEEGGKAPTQTEFPLSSLDSFPSIPFFRSKSARIDTTS
QSSTQKEDRLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLVASEDNGSGNQENDKV
ILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFDTKIACE
Download sequence
Identical sequences K4AAU1
XP_004984375.1.39314 XP_004984378.1.39314 XP_004984379.1.39314 XP_004984380.1.39314 XP_014660047.1.39314 Si035988m|PACid:19685540 Si035991m|PACid:19685542 Si035994m|PACid:19685539 Si035997m|PACid:19685543 Si035998m|PACid:19685541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]