SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036032m|PACid:19682025 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si036032m|PACid:19682025
Domain Number - Region: 4-43
Classification Level Classification E-value
Superfamily F-box domain 0.0275
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si036032m|PACid:19682025
Sequence length 395
Sequence
MARPEDLKDDLVLEISRRLPCRLDRASMAATCRTWEAALTREAAAALLRQLPVLFFPKAE
GPSFSCLSCGGALHDLALLPYGITGARLIGSRPSSWWFAATGFLNGHVLSNTATGQQIQV
PDSMRFGRGDKIIVVQILAANVSAIPNDQVPAALCYGAALVKRGAFPDVMFWRLHQQIGL
SSRSVAFDWARRAADVIHHNGVFKFLTQDERLVFVVPEITDGDLELHADVWAPAVDVPGV
EPLEEHIGIDARYLVVSRGELLMLRRYRVMKWWTESFRVYRLERLHLGQSPEEDHYTWVE
LTELGGRILFVARGCSIAFEVQDFAEYPAAVEGVYFKGDVDEFTDGWCAMETLGRATMLS
DCGRWSFPRNNDPCFEIPDQVDGTFEHSAAAWLFL
Download sequence
Identical sequences K4AAX5
XP_004985309.1.39314 Si036032m|PACid:19682025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]