SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036093m|PACid:19683350 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036093m|PACid:19683350
Domain Number 1 Region: 81-332
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-46
Family Kelch motif 0.001
Further Details:      
 
Domain Number 2 Region: 20-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000245
Family F-box domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si036093m|PACid:19683350
Sequence length 388
Sequence
MCMQPEVKQTKRKSRGSRKERCRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRMVCKRWN
RLLSGNYFYSLRKKIGVAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPSEYSEALG
FGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINNCLY
VAGGECEGIQRTLQSAEVYDPNRNRWACITEMNNGMVPFIGVVYDGKWFLKGLDSHRQVT
SEVYLPSSNAWSTIDDEMVTGWRNPSISFNGRLYSVDCRDGCKLRVYDDSTGTWTRFMDS
KHHLGSSRAFEAAALVSLNGKLCIIRNNMSITLVDVSDPTMSVETDSARMWETVARKGQH
RSFVANLWSTIAGRNLKSHIIHCQVLQV
Download sequence
Identical sequences K4AB36
Si036093m|PACid:19683350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]