SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036114m|PACid:19683869 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036114m|PACid:19683869
Domain Number 1 Region: 11-79
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000314
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si036114m|PACid:19683869
Domain Number - Region: 94-229
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00798
Family Galactose oxidase, central domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si036114m|PACid:19683869
Sequence length 386
Sequence
MSFSGTPLDDDDLLTQVLLFLPSPSSLGHASLVCKRWHQLISDPRFHRRFCACHQKPPLL
GVFSTDSICSGNIYFTPTPDSPDHTPAVARLVVCLGSGSEILGCRHGRLLASNWARHHFC
VWDPITGDQRHVTFPQAFDGRRKVVMNGALICVAREQSHVHGSCCSGPFQVVLLGRTARR
IFACVYSSETGAWGNCTSILRGHFRAVSANHSSTRVGNSICWLLTGQSLAILEFDMHLQR
LAVIEVPSDALDPDNFIQVSIMPADGGGLGFLVLSYSIIQLWRRKDTCDGVAEWVLRNTI
EMSSTLSLRPQSLVENPPLILGFAEEDNVLFLFIDFDIFMLNIGSVKFKKLAEDMGYRLC
HPFTSFYIPGMGIGSGHGGVQIQHNA
Download sequence
Identical sequences K4AB57
Si036108m|PACid:19683868 Si036114m|PACid:19683869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]