SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036166m|PACid:19681694 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036166m|PACid:19681694
Domain Number 1 Region: 4-40
Classification Level Classification E-value
Superfamily F-box domain 0.0000628
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si036166m|PACid:19681694
Sequence length 380
Sequence
MADWTGLHGDLLDLVVVRLPSLDLLRFRAVCASWRAAATAFTTRRGQPRPDRPWLLLPAD
VATDHDHGRLVVRADHEVPVATLPARLGRLTSRRFVPLGSARGAIVAADDRGEMHLLDPV
TGGRWPLPPVATLPLVARVEGLQVQHRGGGVLPVGALIQKAVPVPTPDGGVMVVAIYRQL
QHRNQWATARPGDRAWKSVAPTSIPAVIDVVVHRGQLYANTRYGMMYMFPELHGLGSASP
EIIPSVTRRPSAYVERSFLVESPRGELMQVELLRPVRAAGGEGFVVRVLDECGETWEETE
DIGDAAVLVDATGAVAASTAECPALRPNTVYFAVDLEGETRVWAYSLAGRHKRIEVVEAL
PTAEGYKPPCFWFAQVYSQP
Download sequence
Identical sequences K4ABA9
XP_004982024.1.39314 Si036166m|PACid:19681694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]