SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036183m|PACid:19682658 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036183m|PACid:19682658
Domain Number 1 Region: 4-39
Classification Level Classification E-value
Superfamily F-box domain 0.00000903
Family F-box domain 0.0059
Further Details:      
 
Weak hits

Sequence:  Si036183m|PACid:19682658
Domain Number - Region: 72-203
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00745
Family Tricorn protease N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si036183m|PACid:19682658
Sequence length 378
Sequence
MAGGGWSSLPADFLRLVSSRLTSADDVLHVRQVCHHWRAPVPVAPFRPWVVATRAKPIRV
GPLGDCSHWLPAGLKRVQLATPPGLPYCCGTPRGWLALADDERSPTRLVLWEPRSGAEIP
LPPLACVVQVFISADPLASSSSSWLAVATQVRSEFHRDILFWRPGDRAWSAAADRVYTSE
RLHSVAFLGGKMYCMDYSKRLAIYGLNLGTNSPPMLLQSMHAVSLLNMLCNRRCGKKLHG
TRAAHFVSCNDELLLVVLFNNGHPSFAEPPLEFGERLEDLGGYSLFLGRGDAFALSPQEF
PAIKRNCIYYAVHFLNVQIKDWVFVFNLESDVLEEFPFPTEHKEDPANTWWPVSWFCPKR
PIFRSGSKAEANLDAIIR
Download sequence
Identical sequences K4ABC6
Si036183m|PACid:19682658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]