SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036222m|PACid:19679034 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036222m|PACid:19679034
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000471
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  Si036222m|PACid:19679034
Domain Number - Region: 97-347
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0149
Family Quinoprotein alcohol dehydrogenase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si036222m|PACid:19679034
Sequence length 375
Sequence
MTLPDDVLIDIFLLLPPHPSCLLRASLVCKHWHSLILDNRFLHRFQALHGLPVLGVFTNS
TRIPRFLPVGDPPNRVAAASFSLPDIHWHVLGCRHSHILLIGSTWNQLLVWNPINGHERL
ISAPPDVDPRFNYGHVPESNAAVVCAANHADHGYCHSCPFFVIWVFTTTHYAYATRYSSE
SRSWEMMASSPIPSDVDFRPSILVRNILYWPLKSKYILAFELVTHRLYHIECPPETHDIY
RRNVHMMKTEDGGLGLAAVTKFNLRLWAWDTDVKGVTGWVLRRIIELDKFLPLELSSLPS
MDNRPCGRPPVRILGLVEDDDLVFIWTKTGVFTVQLKTMKHKKVFEADVSASVYPYTGFR
IAGAVAHDGGNVAAE
Download sequence
Identical sequences K4ABG5
Si036222m|PACid:19679034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]