SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036251m|PACid:19683485 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036251m|PACid:19683485
Domain Number 1 Region: 15-57
Classification Level Classification E-value
Superfamily F-box domain 0.0000000379
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si036251m|PACid:19683485
Sequence length 371
Sequence
MQSKHRIFAEDLLLAAEGEDHFDRVPDSLVLIIFNKLADARSLGRCSAVSRRFNALVPLV
DDACLRIDRVIPADGGDGADALGLAGAPRPRAVLSHLLKAMLNAVLKPFAHCDAKSGAHG
GKHSQQQQHHSPAQVLKNFSSIRNLRMELPVSDVGTDDGVILKWKAVFGSTLQSCVILGG
TKVERAAAGTHAPMAAAAAATDSDGAGDESGSIPESFYTNGGLKLRVVWTISSLIAAATR
HYLLREIVKEHPTLEQVALTDAHGQGTLSMGRDQLKEFRDKPLAAAAAANRTQVPACNMK
LRYAPLLELSDGTRIHGATLVVIKPVGESGGIGGGRKELDDFVADTFNGPFREAVGVLSK
RRTYLLEMNGF
Download sequence
Identical sequences K4ABJ4
Si036251m|PACid:19683485 XP_004984553.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]