SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036416m|PACid:19685788 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036416m|PACid:19685788
Domain Number 1 Region: 63-254
Classification Level Classification E-value
Superfamily Kelch motif 1.27e-36
Family Kelch motif 0.0015
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily F-box domain 0.000000392
Family F-box domain 0.013
Further Details:      
 
Domain Number 3 Region: 278-345
Classification Level Classification E-value
Superfamily Kelch motif 0.00000131
Family Kelch motif 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si036416m|PACid:19685788
Sequence length 348
Sequence
MASTLLDGLPNEVALQCLARVPFLFHPMLQLVCRSWRASVRSGDLLKIRNQIGATEELLC
VLAFEPENMWQLYDPLRDKWITLPVMPSQIRNIARFGVASVAGKLYVIGGGSDRVDPLTG
DHDRIFASNEVWSYDPLQRVWSQRAPMLVARAMFACCALDGKIIVAGGFTNCRKSISKAE
IYDPEADMWEPLPDLRQAHSSACSGLVIKGKMHVLHKGLSTVQILEDGGSHWAVEDFSWL
QGPMAMVGGELYVLSNSCIMKQRGENFPDKMVSCASEFQSRIGFGMIGLGNSIYLVGGVI
GPGPRNQCIKPLSDVDILNVTSERPTWRPGSPMTHCRGSICGCALLRI
Download sequence
Identical sequences K4AC09
Si036416m|PACid:19685788 XP_004983256.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]