SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036814m|PACid:19685696 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036814m|PACid:19685696
Domain Number 1 Region: 109-280
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.47e-27
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.011
Further Details:      
 
Domain Number 2 Region: 14-75
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000222
Family F-box domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si036814m|PACid:19685696
Sequence length 300
Sequence
MEAASGGRRGPALGALAVLPDEVLCAVVDLLPPADIGRLACVSSAMYILCNEEPLWMSKC
LSIGGPLEYKGSWKKTTLSRLGLCSENDENWQKPRQFDGFSSLYLYRRWYRCVTSLSSFS
FDDGHVERKDDLVLDQFRSQYDGKGPVLLTKLAETWPARTKWTLQQLTRDFGEVPFRISQ
RSPQKITMKLKDYVSYMELQHDEDPLYIFDDKFGESVPALLKDYSVPHLFQEDFFDILDY
DQRPAFRWFIIGPERSGASWHVDPGLTSAWNTLLCGRKRFGPPFVLTILVNMPVRLQWVM
Download sequence
Identical sequences K4AD57
Si036814m|PACid:19685696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]