SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036822m|PACid:19679090 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036822m|PACid:19679090
Domain Number 1 Region: 20-104
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000245
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si036822m|PACid:19679090
Sequence length 299
Sequence
MGAWVSGLLGADCAAAEAAAGPAAVGLGDLPELCAAQVLLRLDPPEICRLARLNHAFRGA
AGADFVWEAKLPENYRYLMEFVGSGEEGRRRRRRAGKKEIYARLSKPVPFGDGQKEFWLD
KSRGMICMALSSKALVITGIDDRRYWQHMPTSESRFQSVAYLQQIWWFEVVGEVDFCFPV
GTYSLYFRVHLGKFYKRFGRRHCSSEHVHGWNKKPVRFQLSTSDGQQVLSQCYLEEPGSW
VLYHAGDFVASKPDQQMKLKFSMAQIDCTHTKGGLCVDSVLIYPKGKGFQQGRVVRSQR
Download sequence
Identical sequences K4AD65
XP_004983881.1.39314 Si036822m|PACid:19679090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]