SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036828m|PACid:19683373 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036828m|PACid:19683373
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000118
Family F-box domain 0.0041
Further Details:      
 
Domain Number 2 Region: 128-251
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000196
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si036828m|PACid:19683373
Sequence length 298
Sequence
MEKAAPPIPTQETGAAAPPWADMETDCLAHVFRRLDLEDLAAAAPLVCRGWRRAVADPSL
WRALDLRRDHVARFMPWAPLAAAFARRYGVPRFALGGFLRICVARAQGSADDVALPPLLA
SPAADLDHISLQCPRLRRLALPQLPAGDEARLPDLIPRWPLLEHLELDAKPSSASFPALA
AQLGRHCPNFVSLKTSGAVKPEDAAALARSLPRLRSLCLDRSYLPKQELLAIIAGCRDLR
ELSARGCVGFDEGDEEVARRGARMERFDVTGSRMIDELQDELAGGGDDLCDSSYVDVM
Download sequence
Identical sequences K4AD71
XP_004982353.1.39314 Si036828m|PACid:19683373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]