SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si036847m|PACid:19685285 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036847m|PACid:19685285
Domain Number 1 Region: 12-57
Classification Level Classification E-value
Superfamily F-box domain 0.000000000458
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si036847m|PACid:19685285
Sequence length 295
Sequence
MAGDHELTLTQVGDLPEVCLAHAIALTSPRDACRCAAVSPAFRAAADSDHVWRRFLPPGH
RGATVLLPQGPPAKSTETSKDAYLRLCDAAVIVDGEGNGSMRMWLDKASGAKCYMLSARA
LSLPWDDGEFSWRWTPHPLSRFGDVAELVECSSLDIYGRLPAAELTPATSYAAYLVYGVA
EGHRGLSYPDQETTVALGGGLVAAARARHAVCLHPAEEAEARKFRAVSRGAGEDSPRRPR
LREDGWSEMEMGRLRTPSDGGGQEADQEVVVSFEVLGWYPKRGLIVEGVEFRPVN
Download sequence
Identical sequences K4AD90
XP_004984419.1.39314 Si036847m|PACid:19685285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]