SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si037068m|PACid:19683876 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si037068m|PACid:19683876
Domain Number 1 Region: 105-146
Classification Level Classification E-value
Superfamily F-box domain 0.0000116
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si037068m|PACid:19683876
Sequence length 264
Sequence
MGSGSVTLKQKKRVKNAKNKYLKPGALAQIRYSRSTSRDIGKKRILLNAKDELEISPQAG
IIIESTTPILSPARLNFEPFGSNKGQILPRTPRTPVAAEFDGDSRLESLPLDLLIKIMCC
LHHDQLKAVFHVSKRIRKAVELARQYHFNYTTPDRSRQELLLNKTPLPTEHWPFLRIDGK
DVRVSTPRTPRAPKHAARLSRLKLVDVKPITAVLFQESSTFPSKRLRRSVPPGLPRPVSK
TAPSPRVLRYEEELCEAVAQNKLL
Download sequence
Identical sequences K4ADW1
Si037068m|PACid:19683876 XP_004983038.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]