SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si037143m|PACid:19683879 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si037143m|PACid:19683879
Domain Number 1 Region: 41-98,139-159
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000157
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si037143m|PACid:19683879
Sequence length 253
Sequence
MAERKRKRAAEEWERRKRDHRRRRREGQGKGEELLGKRQVGWAGDPVEALGEVVMGRVME
LLDARSVARCTVVSRAWRGVAADDRLWAPKCAELMAGKAHIPRLTLIRTGSKLSTYSMAI
MDGKRSRITKEDLCDHAWEYCFTIAAPEYWRNLDPSWKHTGPPMRRYFHPDGYHSADPHD
AVWGGHECTYTVITSFVGDGRIREHYVRINRWPPLKVSRKDDWSWELSNHLYRYNSIPDA
DRKGCTGPLFPVW
Download sequence
Identical sequences K4AE36
XP_004982956.1.39314 Si037143m|PACid:19683879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]