SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si037158m|PACid:19683733 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si037158m|PACid:19683733
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily F-box domain 7.1e-18
Family F-box domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si037158m|PACid:19683733
Sequence length 250
Sequence
MENEFPDEVLKSVFPLLDGKDLVFCMLVCRQWRDIAKDDYFWKCICSRKWPSICKQPPSD
ANYKKLYLTFSQPPTMQHLPVPRLTFEDLVFYIDMWLEGSLIFSQAISGCTLRAGLQCTP
RGIPDILAAHLKSLDCIMMLEVEPRLSIPMGPAITVSVLAHRKDSNKMACIINKSTFDYI
DSNAARALAYEYLRFSPRHPFISDIRAWMSLLFLYKGDNVVEVFGIELDFCDAARSETEI
LWLLDMLDWK
Download sequence
Identical sequences K4AE51
XP_004983992.1.39314 Si037158m|PACid:19683733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]