SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si037159m|PACid:19683472 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si037159m|PACid:19683472
Domain Number - Region: 21-90
Classification Level Classification E-value
Superfamily F-box domain 0.00105
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si037159m|PACid:19683472
Sequence length 250
Sequence
MELVVKRYRCTHSATCVCLKGHISEDAMYLVFEHMKWNPKMIAIFSSVCKWFDEFAKRVL
WKEFCHARAPKMMTDLHSDGSHIVDGNWKALGKLLIYCSACPRGDLFSNIHVPIPGHFVY
RTRFSRTLGKSLVPPQCKSDVLYVSDSCEHLDQGEEGDLGLFRGIFKSFAGSNMKKMLIE
RQATFHPNEVCPYCKTKLWHLMQPNMIPSSASVRLDADDDSVEYYVCLNGHIIGSCTLMP
YSDSEDTKEE
Download sequence
Identical sequences K4AE52
Si037159m|PACid:19683472 XP_004983983.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]