SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si037160m|PACid:19685288 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si037160m|PACid:19685288
Domain Number 1 Region: 34-99
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000903
Family F-box domain 0.0049
Further Details:      
 
Domain Number 2 Region: 108-152
Classification Level Classification E-value
Superfamily LysM domain 0.000000249
Family LysM domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si037160m|PACid:19685288
Sequence length 250
Sequence
MDSRGADGAAGGPDASSPADPPGPEPDPAADAMDARLPADLLRAVLQRLPPIDLARSACV
CRAWHAVASDRAVLEAAFCAPWGVRRVVGDPATQAFWRAASLGRFALSHAVRRGDTVPGV
ALKYSVQVTDIKRFNNMMSDHGIYSRERLLIPISNPEILLGSTCYIEMDHNAKREVAVFY
PEGRPSGTESLANIISKERRSRRILESVRRSLHVDDGTAAYYLSVSEGDPRAAMMEYSED
LRWEQQRSGQ
Download sequence
Identical sequences K4AE53
Si037160m|PACid:19685288 XP_004982084.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]