SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si037671m|PACid:19683880 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si037671m|PACid:19683880
Domain Number 1 Region: 40-96
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000432
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si037671m|PACid:19683880
Sequence length 186
Sequence
MAERKRKRAAEEWERRKRDHRRRRREGQGKGEELLGKRQVGWAGDPVEALGEVVMGRVME
LLDARSVARCTVVSRAWRGVAADDRLWAPKCAELMAGKAHIPRLTLIRTGSKLSTYSMAI
MDGKRSRITKEDLCDHAWEYCFTIALLLTPGPLSSLSACPGGAVANSPPQFHSRSRVLLL
LLHRCP
Download sequence
Identical sequences K4AFL3
Si037670m|PACid:19683881 Si037671m|PACid:19683880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]