SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038530m|PACid:19683723 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038530m|PACid:19683723
Domain Number 1 Region: 36-111
Classification Level Classification E-value
Superfamily F-box domain 0.000000638
Family F-box domain 0.0095
Further Details:      
 
Weak hits

Sequence:  Si038530m|PACid:19683723
Domain Number - Region: 222-389
Classification Level Classification E-value
Superfamily RNI-like 0.000534
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si038530m|PACid:19683723
Sequence length 398
Sequence
MAACHGTGALLPSIASGFHSIARLSIIGTGGRTLYPMDSAGDIDRISALPDDLLHAILAG
VGEATAVTRTAVLSKRWRCVWIHAQHLEFEDTKVSRDALPADYCFADFVDWVFACRGDAD
IGSLEISLSRHDLCASPERVNGWLRRYAMRRAGLQHDEPAVVMPSHGRMASIEMHLSRRT
FQLPVAAAARYEALTELVLCSASFDEAAAAAGGGRTLGDFVSSCCPRLRKLEVMSPRGLP
QLVIRSETLQELTLVWAGDLHMLDVAAPSLLVLKLDCEHVISKKVARIAAPTPRLEEIAI
HYLPGRRRPNLDIHDTASVRRLNNFHLHMHGPYCVDDDNLRLLKNCPGVEHIGVSLVQEM
GATNSGLVDLTTEGHDHALLCPHLRSLSVHITETIEVS
Download sequence
Identical sequences K4AI23
Si038530m|PACid:19683723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]